Skip to product information
1 of 1

Gene Bio Systems

Recombinant Putative amino-acid transporter Rv0488-MT0507 (Rv0488, MT0507)

Recombinant Putative amino-acid transporter Rv0488-MT0507 (Rv0488, MT0507)

SKU:CSB-CF354959MVZ

Regular price $2,165.80 CAD
Regular price Sale price $2,165.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64711

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLV ARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCLVVTFLNPHVYLDTVVL IGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFATPAAWRILDALVAVTMIG VAVVVLVTSPSVPTANVALII

Protein Names:Recommended name: Putative amino-acid transporter Rv0488/MT0507

Gene Names:Ordered Locus Names:Rv0488, MT0507 ORF Names:MTCY20G9.14

Expression Region:1-201

Sequence Info:full length protein

View full details