Skip to product information
1 of 1

Gene Bio Systems

Recombinant Psychrobacter sp. UPF0059 membrane protein PsycPRwf_0006 (PsycPRwf_0006)

Recombinant Psychrobacter sp. UPF0059 membrane protein PsycPRwf_0006 (PsycPRwf_0006)

SKU:CSB-CF405416PZR

Regular price $2,157.40 CAD
Regular price Sale price $2,157.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Psychrobacter sp. (strain PRwf-1)

Uniprot NO.:A5WBC5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIDVLFLAIALAMDAFAVSIGLGAKQANTAFSSAAKAKSMLLKLALMAALYFGVAQGVMP LIGYLLGSALLGWLASAAPWIGCIILIGLGAKMLYEAIQGDHEEEELGLDDNQSVDHKLM GTMAIATSIDAMAAGFTLNLLAVNAWLACLIIALVTALFSFFGVYLGRQSGTWLEDKAEV VGGVVLIAIGIKMVL

Protein Names:Recommended name: UPF0059 membrane protein PsycPRwf_0006

Gene Names:Ordered Locus Names:PsycPRwf_0006

Expression Region:1-195

Sequence Info:full length protein

View full details