Gene Bio Systems
Recombinant Psychrobacter arcticus UPF0060 membrane protein Psyc_0916(Psyc_0916)
Recombinant Psychrobacter arcticus UPF0060 membrane protein Psyc_0916(Psyc_0916)
SKU:CSB-CF670074PAAV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Psychrobacter arcticus (strain DSM 17307 / 273-4)
Uniprot NO.:Q4FT89
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSELKTVGLFAITALAEIAGCYLPYLWLREGKSIWLLIPGALSLVAFVWLLSLHPTAAGR TYAAYGGVYISMAILWLWTVNGIRPTTWDIVGSVVALIGMAIIMFAPRSV
Protein Names:Recommended name: UPF0060 membrane protein Psyc_0916
Gene Names:Ordered Locus Names:Psyc_0916
Expression Region:1-110
Sequence Info:full length protein
