Gene Bio Systems
Recombinant Pseudomonas syringae pv. tomato Disulfide bond formation protein B(dsbB)
Recombinant Pseudomonas syringae pv. tomato Disulfide bond formation protein B(dsbB)
SKU:CSB-CF775100FGP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas syringae pv. tomato (strain DC3000)
Uniprot NO.:Q887H2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNDTFYLKREKRFLVLLGIICLSLIGGALYMQIALGEAPCPLCILQRYALLFIAIFAFI GAAMNGRRGVTVFEALVTLSALCGIAAAGRHAWILAHPSDSCGIDILQPIVDGLPLATLF PTGFQVSGFCTTPYPPVLGLSLAQWALTAFVLTAILVPACIIRNRRKPY
Protein Names:Recommended name: Disulfide bond formation protein B Alternative name(s): Disulfide oxidoreductase
Gene Names:Name:dsbB Ordered Locus Names:PSPTO_1324
Expression Region:1-169
Sequence Info:full length protein
