Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas syringae pv. phaseolicola Disulfide bond formation protein B 2(dsbB2)

Recombinant Pseudomonas syringae pv. phaseolicola Disulfide bond formation protein B 2(dsbB2)

SKU:CSB-CF674239PAAT

Regular price $2,128.00 CAD
Regular price Sale price $2,128.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6)

Uniprot NO.:Q48QE1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYLARTRFLFFLASLACASIIGTAFYLQQTFGLDPCFLCLIQRAAIIACGVLALCAACHA PGPTGMRRYSLGFLLIALTGLVTAGAQVWLQTASADQLIPFITKLEHLLSLLSLDMCIDR LRSDAMFCAEITWTLFGISLPEWSLLAFTGLALLPLYPLFSEFSHWLATKDRARY

Protein Names:Recommended name: Disulfide bond formation protein B 2 Alternative name(s): Disulfide oxidoreductase 2

Gene Names:Name:dsbB2 Ordered Locus Names:PSPPH_0063

Expression Region:1-175

Sequence Info:full length protein

View full details