Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas sp. Carboxypeptidase G2(cpg2)

Recombinant Pseudomonas sp. Carboxypeptidase G2(cpg2)

SKU:CSB-EP361895PVV

Regular price $1,332.50 CAD
Regular price Sale price $1,332.50 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P06621

Gene Names: cpg2

Organism: Pseudomonas sp. (strain RS-16)

AA Sequence: ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK

Expression Region: 23-415aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 68.7 kDa

Alternative Name(s): Folate hydrolase G2Glutamate carboxypeptidasePteroylmonoglutamic acid hydrolase G2INN: Glucarpidase

Relevance: Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity.

Reference: Crystal structure of carboxypeptidase G2, a bacterial enzyme with applications in cancer therapy.Rowsell S., Pauptit R.A., Tucker A.D., Melton R.G., Blow D.M., Brick P.Structure 5:337-347(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details