Gene Bio Systems
Recombinant Pseudomonas putida UPF0114 protein PputW619_4503 (PputW619_4503)
Recombinant Pseudomonas putida UPF0114 protein PputW619_4503 (PputW619_4503)
SKU:CSB-CF541780FGC
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas putida (strain W619)
Uniprot NO.:B1JF19
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MERILENAMYASRWLLAPIYFGLSLGLLALALKFFQEVIHVLPNVFALSEADLILVILSL IDMSLVGGLLVMVMISGYENFVSQLDIDDSKEKLNWLGKMDSSSLKMKVAASIVAISSIH LLRVFMDAQNISTDYLMWYVIIHMTFVVSAFCMGYLDKVTKH
Protein Names:Recommended name: UPF0114 protein PputW619_4503
Gene Names:Ordered Locus Names:PputW619_4503
Expression Region:1-162
Sequence Info:full length protein
