Gene Bio Systems
Recombinant Pseudomonas phage phi6 Fusion protein P6(P6)
Recombinant Pseudomonas phage phi6 Fusion protein P6(P6)
SKU:CSB-CF320830PUV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas phage phi6 (Bacteriophage phi-6)
Uniprot NO.:P11128
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SIFSSLFKVIKKVISKVVATLKKIFKKIWPLLLIVAIIYFAPYLAGFFTSAGFTGIGGIF SSIATTITPTLTSFLSTAWSGVGSLASTAWSGFQSLGMGTQLAVVSGAAALIAPEETAQL VTEIGTTVGDIAGTIIGGVAKALPGWIWIAAGGLAVWALWPSSDSKE
Protein Names:Recommended name: Fusion protein P6
Gene Names:Name:P6
Expression Region:2-168
Sequence Info:full length protein
