Gene Bio Systems
Recombinant Pseudomonas fluorescens UPF0114 protein PFLU_5318 (PFLU_5318)
Recombinant Pseudomonas fluorescens UPF0114 protein PFLU_5318 (PFLU_5318)
SKU:CSB-CF500949FFU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas fluorescens (strain SBW25)
Uniprot NO.:C3K2C1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MERFIENAMYASRWLLAPIYFGLSLGLLALALKFFQEVIHLLPSVFSMAESELILVLLSL IDMALVGGLLVMVMISGYENFVSQLDIDDNKEKLNWLGTMDSSSLKMKVAASIVAISSIH LLRIFMDAKNVDPQHLMWYVIIHMTFVVSAFAMGYLDKVTKH
Protein Names:Recommended name: UPF0114 protein PFLU_5318
Gene Names:Ordered Locus Names:PFLU_5318
Expression Region:1-162
Sequence Info:full length protein
