Gene Bio Systems
Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 1(nuoA1)
Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 1(nuoA1)
SKU:CSB-CF412808PZL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas aeruginosa (strain PA7)
Uniprot NO.:A6V4E9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPNPAELAAHHWGFAAFLLGVVGLLAFMLGVSALLGSKAFGRSKNEPFESGIVPTGGARL RLSAKFYLVAMLFVIFDVEALFLFAWSVSVRESGWAGLIEATIFIAILLAGLVYLWRIGA LDWAPESRRKRQAKLKQ
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A 1 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A 1 NDH-1 subunit A 1 NUO1 1
Gene Names:Name:nuoA1 Ordered Locus Names:PSPA7_2570
Expression Region:1-137
Sequence Info:full length protein
