Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfE(rnfE)

Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfE(rnfE)

SKU:CSB-CF407845PZL

Regular price $2,221.80 CAD
Regular price Sale price $2,221.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain PA7)

Uniprot NO.:A6V1T4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEQGLREIARDGLWRNNPGLVQLLGLCPLLGTSNSTVNALGLGLATLLVLVCSNAAVSL VRGAVSEAIRLPAFVMIIAALTTCIELLMQAWTYELYQILGIFIPLITTNCVILGRAEAF AAKNGVLRASFDGLLTGLGFALVLLVLGGLRELLGQGTLLADMQLLFGPAAETWKIQIFP HYQGFLLAILPPGAFIMLGLLIALKNRIDESLAERARAQAGDVPASPQRQRVRVTGVIE

Protein Names:Recommended name: Electron transport complex protein RnfE

Gene Names:Name:rnfE Ordered Locus Names:PSPA7_1635

Expression Region:1-239

Sequence Info:full length protein

View full details