Gene Bio Systems
Recombinant Pseudomonas aeruginosa Disulfide bond formation protein B 1(dsbB1)
Recombinant Pseudomonas aeruginosa Disulfide bond formation protein B 1(dsbB1)
SKU:CSB-CF324203EZX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Uniprot NO.:P21482
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPLASPRQLFLLAFLACVAIMGGALYLEHVVGLEACPLCVVQRIFFILIGLTCLAGAIQG PGLRGRRIYSVLVFLLALGGGATAARQVWLQTVPLDQLPACLPSLDYMMQALPFQEVIRL VLHGTADCAQVSWTLFTLSIPEWSLLAFVAYLGFSIVQFLRRA
Protein Names:Recommended name: Disulfide bond formation protein B 1 Alternative name(s): Disulfide oxidoreductase 1
Gene Names:Name:dsbB1 Ordered Locus Names:PA5256
Expression Region:1-163
Sequence Info:full length protein
