Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa Chemotactic transduction protein ChpE(chpE)

Recombinant Pseudomonas aeruginosa Chemotactic transduction protein ChpE(chpE)

SKU:CSB-CF530789EZX

Regular price $2,168.60 CAD
Regular price Sale price $2,168.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Uniprot NO.:O87005

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLAIFLAALLFGFAFNVSPGAVFSETLRRGLTGGFRPALLVQLGSLIGDAVWALLGLTGL ALLLGYEQVRIPLTLACAAYLAWLGVQGLRDAWSPPLAAEDAGEQGRNAFGAGAAISLSN PKNVVYWGALGSALAGIVDGTPNQAQSLVFFAGFMLSSLIWCFCCAALVDWLRRNTSLFW HRVSYAGCGVLLLGLAGLALRGL

Protein Names:Recommended name: Chemotactic transduction protein ChpE

Gene Names:Name:chpE Ordered Locus Names:PA0417

Expression Region:1-203

Sequence Info:full length protein

View full details