Skip to product information
1 of 1

Gene Bio Systems

Recombinant Prunus dulcis x Prunus persica Putative allergen Pru p 1.01(Pru p 1.01)

Recombinant Prunus dulcis x Prunus persica Putative allergen Pru p 1.01(Pru p 1.01)

SKU:CSB-EP2030EZJ

Regular price $1,492.40 CAD
Regular price Sale price $1,492.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Allergen

Uniprot ID: B6CQR8

Gene Names: Pru p 1.01

Organism: Prunus dulcis x Prunus persica

AA Sequence: MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN

Expression Region: 1-160aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.6 kDa

Alternative Name(s):

Relevance:

Reference: "Genomic characterization of putative allergen genes in peach/almond and their synteny with apple."Chen L., Zhang S., Illa E., Song L., Wu S., Howad W., Arus P., van de Weg E., Chen K., Gao Z.BMC Genomics 9:543-543(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details