Skip to product information
1 of 1

Gene Bio Systems

Recombinant Proteus mirabilis UPF0059 membrane protein PMI1608 (PMI1608)

Recombinant Proteus mirabilis UPF0059 membrane protein PMI1608 (PMI1608)

SKU:CSB-CF463449EYZ

Regular price $2,156.00 CAD
Regular price Sale price $2,156.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Proteus mirabilis (strain HI4320)

Uniprot NO.:B4EYC2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFYATIILALALSMDAFAVAVCKGATLHKPHFREALRTGFIFGIIEASTPIIGWALGLY TSQYIIQWDHWVAFGLLVILGGRMIYQSLKRGDDCICEEAPQRHGSLSLIATGIATSLDA MAIGVGLAFLQVDIVHTAMTIGMMTMIMATLGMLIGRYIGPVLGKKAEIIGGMVLIAIGF NILFEHLDLFMYAH

Protein Names:Recommended name: UPF0059 membrane protein PMI1608

Gene Names:Ordered Locus Names:PMI1608

Expression Region:1-194

Sequence Info:full length protein

View full details