Gene Bio Systems
Recombinant Propionibacterium acnes Protein CrcB homolog 1(crcB1)
Recombinant Propionibacterium acnes Protein CrcB homolog 1(crcB1)
SKU:CSB-CF734796PSG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Propionibacterium acnes (strain KPA171202 / DSM 16379)
Uniprot NO.:Q6A9P0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAMRSGFLDRRPVLVGLVFLGGCLGTLIRSVIAHAWPSRADGVPWGTLAINLVGAFVLAT LLELLVHAGPDRGVRRAVRLCIGTGLLGGFTTYSALTVEAGQRVMSGQWLWGIAYLLTSV AAGALLAWVVIAAVRCVMGKRSS
Protein Names:Recommended name: Protein CrcB homolog 1
Gene Names:Name:crcB1 Ordered Locus Names:PPA0770
Expression Region:1-143
Sequence Info:full length protein
