
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)
Uniprot NO.:Q7UZM7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNKKYLLTFLLTAYCATFLRFYFKNNFVISIIGSFLYGFFISRKISKSKKEILFSGFFAC FTSFSGFVHFLYQFIIQGYYLKLFIYLNVIVILNLIIMYIGFQLSRKIT
Protein Names:Recommended name: Protein CrcB homolog 1
Gene Names:Name:crcB1 Ordered Locus Names:PMM1631
Expression Region:1-109
Sequence Info:full length protein