Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b559 subunit alpha(psbE)

SKU: CSB-CF763369EYQ

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Uniprot NO.:Q7V300

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIMAAGSTGERPFFEIITSIRYWIIHAVTLPAIFIAGFLFVYTGLAYDAFGTPRPDSYFQ ASESKAPVVTQRYDAKSQLDLRTK

Protein Names:Recommended name: Cytochrome b559 subunit alpha Alternative name(s): PSII reaction center subunit V

Gene Names:Name:psbE Ordered Locus Names:PMM0297

Expression Region:1-84

Sequence Info:full length protein