Recombinant Prochlorococcus marinus  Photosystem II reaction center X protein(psbX)

Recombinant Prochlorococcus marinus Photosystem II reaction center X protein(psbX)

CSB-CF655967PAAN
Regular price
$1,399.00 CAD
Sale price
$1,399.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Prochlorococcus marinus (strain MIT 9312)

Uniprot NO.:Q31DC0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFQISNLLLAADFSSEVANNSAVGMIGSFIAAALLIVIPATAFLIFVSQKDSLNRTSTGR R

Protein Names:Recommended name: Photosystem II reaction center X protein

Gene Names:Name:psbX Ordered Locus Names:PMT9312_0064

Expression Region:1-61

Sequence Info:full length protein

Your list is ready to share