Gene Bio Systems
Recombinant Prochlorococcus marinus Photosystem II reaction center X protein(psbX)
Recombinant Prochlorococcus marinus Photosystem II reaction center X protein(psbX)
SKU:CSB-CF386956PZE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Prochlorococcus marinus (strain MIT 9301)
Uniprot NO.:A3PAC1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLQISNLLLAADFSAEVANNSAVGMIGSFIAAALLIVIPATAFLIFVSQKDSLDRTSTGR R
Protein Names:Recommended name: Photosystem II reaction center X protein
Gene Names:Name:psbX Ordered Locus Names:P9301_00731
Expression Region:1-61
Sequence Info:full length protein
