Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Prochlorococcus marinus (strain NATL2A)
Uniprot NO.:Q46H79
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSKLKGPDGRAGDRLPNGMPAVSWERRWTEGALPLWLVATAGGTAVIFVLGIFFYGSYTG IGNAG
Protein Names:Recommended name: Photosystem II reaction center protein J Short name= PSII-J
Gene Names:Name:psbJ Ordered Locus Names:PMN2A_1665
Expression Region:1-65
Sequence Info:full length protein