Recombinant Prochlorococcus marinus  Photosystem II reaction center protein J(psbJ)

Recombinant Prochlorococcus marinus Photosystem II reaction center protein J(psbJ)

CSB-CF383224PZF
Regular price
$1,404.00 CAD
Sale price
$1,404.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Prochlorococcus marinus (strain MIT 9303)

Uniprot NO.:A2CCQ3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTKLKGPDGRIPDRLPDGTPAVSWERRWTEGSLPLWLVATVGGMAVLSVLGLFFFGSFT GVGSA

Protein Names:Recommended name: Photosystem II reaction center protein J Short name= PSII-J

Gene Names:Name:psbJ Ordered Locus Names:P9303_25321

Expression Region:1-65

Sequence Info:full length protein

Your list is ready to share