Gene Bio Systems
Recombinant Probable protein E5(E5)
Recombinant Probable protein E5(E5)
SKU:CSB-CF361986HML
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human papillomavirus type 16
Uniprot NO.:P06927
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCF IVYIIFVYIPLFLIHTHARFLIT
Protein Names:Recommended name: Probable protein E5
Gene Names:Name:E5
Expression Region:1-83
Sequence Info:full length protein
