Skip to product information
1 of 1

Gene Bio Systems

Recombinant Probable oxaloacetate decarboxylase gamma chain(oadG)

Recombinant Probable oxaloacetate decarboxylase gamma chain(oadG)

SKU:CSB-CF771605VFE

Regular price $1,995.00 CAD
Regular price Sale price $1,995.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio parahaemolyticus

Uniprot NO.:Q87LR6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTNIGSLLVDAATLMVTGMAVVFIFLTILVYLVRLLSKLVPEEVPEPIAAPKTNTRVQST SSAVSPQVVAAISAAIHQHRASIAK

Protein Names:Recommended name: Probable oxaloacetate decarboxylase gamma chain EC= 4.1.1.3

Gene Names:Name:oadG Ordered Locus Names:VP2545

Expression Region:1-85

Sequence Info:full length protein

View full details