Gene Bio Systems
Recombinant Probable disulfide formation protein
Recombinant Probable disulfide formation protein
SKU:CSB-CF812726PJAF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas resinovorans
Uniprot NO.:Q8GHM3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNPQPSGMTWNLLLLTWLVALISTLSALFIGEVMGQAPCVLCWFQRAFMFPLTVILAIAC YRSDFTVWRYALPLTVIGAALAFVHTLLYAGLIPQPIQPCTATGPSCSGAGMTLFGVVPL PALALFAFIIIAILLIIIRRRTTP
Protein Names:Recommended name: Probable disulfide formation protein Alternative name(s): Disulfide oxidoreductase Thiol-disulfide oxidoreductase
Gene Names:
Expression Region:1-144
Sequence Info:full length protein
