Gene Bio Systems
Recombinant Potato virus X Movement protein TGBp3 (ORF4)
Recombinant Potato virus X Movement protein TGBp3 (ORF4)
SKU:CSB-CF300142PRD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Potato virus X (strain CP) (PVX)
Uniprot NO.:P68832
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEAGAYLNAIIFVLVATIIAVISRGLTRTEPCTIRITGESITVHACHIDSETIKALANLKPLSLERLSFQ
Protein Names:Recommended name: Movement protein TGBp3 Alternative name(s): 7 kDa protein Triple gene block 3 protein Short name= TGBp3
Gene Names:ORF Names:ORF4
Expression Region:1-70
Sequence Info:full length protein
