Gene Bio Systems
Recombinant Porcine respiratory coronavirus Envelope small membrane protein(E)
Recombinant Porcine respiratory coronavirus Envelope small membrane protein(E)
SKU:CSB-CF301685PQD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Porcine respiratory coronavirus (strain 86/137004 / isolate British) (PRCoV) (PRCV)
Uniprot NO.:P69611
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTFPRALTVIDDNGMVISIIFWFLLIIILILLSIALLNIIKLCMVCCNLGRTVIIVPVQH AYDAYKNFMRIKAYNPDGALLV
Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein Alternative name(s): ORF 3 Protein 4 Protein X1
Gene Names:Name:E Synonyms:NS4
Expression Region:1-82
Sequence Info:full length protein
