Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo abelii Tetraspanin-31(TSPAN31)

Recombinant Pongo abelii Tetraspanin-31(TSPAN31)

SKU:CSB-CF712937PYX

Regular price $2,179.80 CAD
Regular price Sale price $2,179.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pongo abelii (Sumatran orangutan)

Uniprot NO.:Q5RAP8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIA VAGLVGAVNHHQVLLFFYMIILGLVFIFQFVISCSCLAINRSKQADVINASWWVMSNKTR DELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKYSDEALKILGGVGL FFSFTEILGVWLAMRFRNLKDPRANPSAFL

Protein Names:Recommended name: Tetraspanin-31 Short name= Tspan-31 Alternative name(s): Sarcoma-amplified sequence homolog

Gene Names:Name:TSPAN31 Synonyms:SAS

Expression Region:1-210

Sequence Info:full length protein

View full details