Gene Bio Systems
Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(NDUFB8)
Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(NDUFB8)
SKU:CSB-CF315366PYX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:P0CB85
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPDLRLNWGEPMHWHLDMFNRNRVDTSPILVSWNVMCMQLFGFLAFMIFMCWVGE VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial Alternative name(s): Complex I-ASHI Short name= CI-ASHI NADH-ubiquinone oxidoreductase ASHI subunit
Gene Names:Name:NDUFB8
Expression Region:29-186
Sequence Info:full length protein
![Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(NDUFB8)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_9c22d53e-cafd-4df9-81cc-640c9e76a988.jpg?v=1659244410&width=1445)