Gene Bio Systems
Recombinant Polystichum munitum Chlorophyll a-b binding protein type 1 member F3, chloroplastic(CABF3)
Recombinant Polystichum munitum Chlorophyll a-b binding protein type 1 member F3, chloroplastic(CABF3)
SKU:CSB-CF323607PPC
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Polystichum munitum (Western swordfern) (Aspidium munitum)
Uniprot NO.:P15195
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAPKSKAPSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLSADPETFAKNRE LEVIHSRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPSLVHAQS ILAIWACQVILMGAVEGYRVAGGPLGEVEDPIYPGGSFDPLGLADDPEAFAELKVKELKN GRLAMFSMFGFFVQAIVTGKGPIENLSDHLADPAVNNAWAYATNFTPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein type 1 member F3, chloroplastic Alternative name(s): Chlorophyll a-b binding protein type I F3 Short name= CAB-F3 LHCP
Gene Names:Name:CABF3
Expression Region:37-265
Sequence Info:full length protein
