Skip to product information
1 of 1

Gene Bio Systems

Recombinant Polaromonas naphthalenivorans UPF0060 membrane protein Pnap_4944 (Pnap_4944)

Recombinant Polaromonas naphthalenivorans UPF0060 membrane protein Pnap_4944 (Pnap_4944)

SKU:CSB-CF380293PYT

Regular price $2,031.40 CAD
Regular price Sale price $2,031.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Polaromonas naphthalenivorans (strain CJ2)

Uniprot NO.:A1VWH8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELLRLAILFAVTALAEIVGCYLPWLVLKQGKSLLLLVPAAMSLGLFAWLLTLHPSAAGR TYAAYGGMYIAVALGWLRFVDGIALTRWDLSGAAIALVGMAVIVMQPSTT

Protein Names:Recommended name: UPF0060 membrane protein Pnap_4944

Gene Names:Ordered Locus Names:Pnap_4944

Expression Region:1-110

Sequence Info:full length protein

View full details