Gene Bio Systems
Recombinant Podospora anserina Signal peptidase complex catalytic subunit SEC11(SEC11)
Recombinant Podospora anserina Signal peptidase complex catalytic subunit SEC11(SEC11)
SKU:CSB-CF460004EXJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Uniprot NO.:B2B3T2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSALGNPRQAAAQLMNFGLILSTAFMMWKGLSVISDSPSPIVVVLSGSMEPAFQRGDLL LLWNRNLFTETSVGEVVVYNVRDKDIPIVHRVISKFGTGFVIPRQWWLFMGIYNNDSDDT KLYAPGQNYLVREDIIGRSVVGYMPFVGYVTIMLSEHPWMKTVMLGIMGLVVVLQRE
Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I
Gene Names:Name:SEC11 ORF Names:CDS Pa_6_7190
Expression Region:1-177
Sequence Info:full length protein
