Recombinant Plasmodium Uncharacterized protein(berghei PBANKA_093100),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Plasmodium Uncharacterized protein(berghei PBANKA_093100),partial

CSB-CF2221PLHa2
Regular price
$886.80 CAD
Sale price
$886.80 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: A0A077XDV0

Gene Names: PBANKA_093100

Organism: Plasmodium berghei (strain Anka)

AA Sequence: QNIKTIFSSFTFYFFFFIFIYAFLLSIMHIFINYFFYIYLFVFNINIYISNIYTIIMTFASLIAIPFSGYIIDNIGSFLFLLLCSSFFILIAISGTIYSCVFNLRSEVIAFISFNLIGISESIIPTVIISQIPTHLCVKKNEDITAAFAIFELVSMLIVSVNNYIFGYFLINKEYLNGLYILFVFVILVISLIFLLIFTIYWKAR

Expression Region: 756-960aa

Sequence Info: Partial

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 39.9 kDa

Alternative Name(s):

Relevance:

Reference: "A comprehensive evaluation of rodent malaria parasite genomes and gene expression." Otto T.D., Bohme U., Jackson A.P., Hunt M., Franke-Fayard B., Hoeijmakers W.A., Religa A.A., Robertson L., Sanders M., Ogun S.A., Cunningham D., Erhart A., Billker O., Khan S.M., Stunnenberg H.G., Langhorne J., Holder A.A., Waters A.P. Janse C.J. BMC Biol. 12:86-86(2014)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share