Recombinant Plasmodium berghei L-lactate dehydrogenase

Recombinant Plasmodium berghei L-lactate dehydrogenase

CSB-EP307560EWN
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Metabolism

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Plasmodium berghei (strain Anka)

Delivery time: 3-7 business days

Uniprot ID: Q7SI97

AA Sequence: MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-316aa

Protein length: Full Length

MW: 39.4 kDa

Alternative Name(s):

Relevance:

Reference: "Crystal structure of Plasmodium berghei lactate dehydrogenase indicates the unique structural differences of these enzymes are shared across the Plasmodium genus." Winter V.J., Cameron A., Tranter R., Sessions R.B., Brady R.L. Mol. Biochem. Parasitol. 131:1-10(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share