Gene Bio Systems
Recombinant Pisum sativum Outer envelope pore protein 16, chloroplastic(OEP16)
Recombinant Pisum sativum Outer envelope pore protein 16, chloroplastic(OEP16)
SKU:CSB-CF672563EWE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pisum sativum (Garden pea)
Uniprot NO.:Q41050
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPRSSFSGSLSSPKLDVVIDMGNPFLNLTVDGFLKIGAVAATRSVAEDTFHIIRKGSISS NDFEKSLKKMCKEGAYWGAIAGVYVGMEYGVERIRGTRDWKNAMFGGAVTGALVSAASNN KKDKIAVDAITGAAIATAAEFINYLT
Protein Names:Recommended name: Outer envelope pore protein 16, chloroplastic Alternative name(s): Chloroplastic outer envelope pore protein of 16 kDa
Gene Names:Name:OEP16
Expression Region:1-146
Sequence Info:full length protein
