Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pisum sativum Chlorophyll a-b binding protein 215, chloroplastic(CAB215)

Recombinant Pisum sativum Chlorophyll a-b binding protein 215, chloroplastic(CAB215)

SKU:CSB-CF340888EWE

Regular price $2,206.40 CAD
Regular price Sale price $2,206.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pisum sativum (Garden pea)

Uniprot NO.:P27520

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RRTVKSAPESIWYGPDRPKYLGPFSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNREL EVIHSRWAMLGALGCTFPELLEKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSI LAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPDSFAELKVKELKNG RLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANNAWAFATNFVPGQ

Protein Names:Recommended name: Chlorophyll a-b binding protein 215, chloroplastic Alternative name(s): LHCII type II CAB-215 Short name= LHCP

Gene Names:Name:CAB215 Synonyms:LHCB2

Expression Region:38-265

Sequence Info:full length protein

View full details