Gene Bio Systems
Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 2
Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 2
SKU:CSB-CF325732PYS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pinus sylvestris (Scots pine)
Uniprot NO.:P15192
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ELLVKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYR VGGGPLGEGLDPLYPGDAFDPLGLADDPEAKAELKVKEIKNGRLAMFSMFGFFVQAIVTG KGPIENLYDHLADPVANNAWAYATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein type 2 member 2 Alternative name(s): Chlorophyll a-b binding protein type II 2 Short name= CAB LHCP
Gene Names:
Expression Region:1-150
Sequence Info:full length protein
