Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 1A, chloroplastic

Recombinant Pinus sylvestris Chlorophyll a-b binding protein type 2 member 1A, chloroplastic

SKU:CSB-CF325336PYS

Regular price $2,213.40 CAD
Regular price Sale price $2,213.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pinus sylvestris (Scots pine)

Uniprot NO.:P15193

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKATGKKSVAASIDSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA KNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLI HAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVK EIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein type 2 member 1A, chloroplastic Alternative name(s): Chlorophyll a-b binding protein type II 1A Short name= CAB LHCP

Gene Names:

Expression Region:46-278

Sequence Info:full length protein

View full details