
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: Q9TVT2
Gene Names: N/A
Organism: Pinctada fucata (Akoya pearl oyster) (Pinctada imbricata fucata)
AA Sequence: AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN
Expression Region: 24-131aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 14.9 kDa
Alternative Name(s):
Relevance: May be specifically involved in the formation of the nacreous layer.
Reference: A new matrix protein family related to the nacreous layer formation of Pinctada fucata.Samata T., Hayashi N., Kono M., Hasegawa K., Horita C., Akera S.FEBS Lett. 462:225-229(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.