Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pilin(traA)

Recombinant Pilin(traA)

SKU:CSB-CF320381ENL

Regular price $1,969.80 CAD
Regular price Sale price $1,969.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli

Uniprot NO.:P14496

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AQGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIA VVMAVVGL

Protein Names:Recommended name: Pilin

Gene Names:Name:traA

Expression Region:52-119

Sequence Info:full length protein

View full details