Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Signal Transduction
Uniprot ID: P17630
Gene Names: TCN1
Organism: Sus scrofa (Pig)
AA Sequence: CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI
Expression Region: 25-416aa
Sequence Info: Full Length of Mature Protein
Source: in vitro E.coli expression system
Tag Info: N-terminal 6xHis-tagged
MW: 48.3 kDa
Alternative Name(s): Cobalophilin Haptocorrin Protein R Transcobalamin I
Relevance: Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach. Binds to cobalamin and to cobalamin analogs such as cobinamide.
Reference: "Isolation and characterization of a cDNA encoding porcine gastric haptocorrin." Hewitt J.E., Seetharam B., Leykam J.F., Alpers D.H. Eur. J. Biochem. 189:125-130(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.