Recombinant Pig Solute carrier family 2, facilitated glucose transporter member 2(SLC2A2)

SKU: CSB-CF021552PI

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:O62786

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VCAIFMSVGLVLLDKLPWMSYVSMTAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPAALA MAAFSNWTRNFIIALCFQYIADFCGPYVFFLFAGVVLVFTLFTFFKVPETKGKSFEEIAA

Protein Names:Recommended name: Solute carrier family 2, facilitated glucose transporter member 2 Alternative name(s): Glucose transporter type 2, liver Short name= GLUT-2

Gene Names:Name:SLC2A2 Synonyms:GLUT2

Expression Region:1-120

Sequence Info:Full length protein