Gene Bio Systems
Recombinant Pig PDZK1-interacting protein 1(PDZK1IP1)
Recombinant Pig PDZK1-interacting protein 1(PDZK1IP1)
SKU:CSB-CF764258PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:Q6ITQ4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSALSLVILGLLMAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAINHFWCQEERE PMNMVMTTGNKADGILIGTEGKYSSMAASFRSNEHENAYENTSEEEGRVHSTPM
Protein Names:Recommended name: PDZK1-interacting protein 1 Alternative name(s): 17 kDa membrane-associated protein
Gene Names:Name:PDZK1IP1 Synonyms:MAP17
Expression Region:1-114
Sequence Info:full length protein
