Skip to product information
1 of 1

GeneBio Systems

Recombinant Pig Interleukin-6 receptor subunit alpha (IL6R), partial

Recombinant Pig Interleukin-6 receptor subunit alpha (IL6R), partial

SKU:O18796

Regular price $1,179.80 CAD
Regular price Sale price $1,179.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: O18796

Gene Names: IL6R

Alternative Name(s): IL-6 receptor subunit alpha;IL-6R subunit alpha;IL-6R-alpha;IL-6RA;IL-6R 1;CD antigen CD126;sIL6R

Abbreviation: Recombinant Pig IL6R protein, partial

Organism: Sus scrofa (Pig)

Source: Yeast

Expression Region: 20-365aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: LAPRGCSKLEVAQDVLTSLPGASVTLTCPGGEPGDNATIHWVLRNQVTGSPDGRPAGVGRRLLLKSVQLSDSGNYSCYQDGVPAGSVRLLVDAPPEEPQLSCFRKSPLSNVGCEWRPRSPPSPTTKAVLLVRKFQNSPVEDFQEPCQYSLEAQRFFCQLAVPEGDNSFHIVTLCVANSAGSQSSTPQTFEGYGILQPDPPVNITVSAVDRNPRWLSVTWQDPPSWNSYFYRLQFELRYRAERSKTFTTWMVKELQHHCIIHDAWSGMRHVVQLRAQEEFGHGLWSEWSQEVTGIPWTESRSSPAETELPLSTQAPTTNEDDEDISSKESANATSLPVQDSASVPLP

MW: 39.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-phase reactions and hematopoiesis. The interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling', the restricted expression of the IL6R limits classic IL6 signaling to only a few tissues such as the liver and some cells of the immune system. Whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6: IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. ; [Interleukin-6 receptor subunit alpha]: Signaling via the membrane-bound IL6R is mostly regenerative and anti-inflammatory. Drives naive CD4(+) T cells to the Th17 lineage, through 'cluster signaling' by dendritic cells. ; [Soluble interleukin-6 receptor subunit alpha]: Soluble form of IL6 receptor (sIL6R) that acts as an agonist of IL6 activity. The IL6: sIL6R complex (hyper-IL6) binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL6R in a process called IL6 'trans-signaling'. sIL6R is causative for the pro-inflammatory properties of IL6 and an important player in the development of chronic inflammatory diseases. In complex with IL6, is required for induction of VEGF production. Plays a protective role during liver injury, being required for maintenance of tissue regeneration. 'Trans-signaling' in central nervous system regulates energy and glucose homeostasis.

Reference:

Function:

View full details