Recombinant Pig Interleukin-33(IL33),partial

Recombinant Pig Interleukin-33(IL33),partial

CSB-EP011656PI
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: M5B263

Gene Names: IL33

Organism: Sus scrofa (Pig)

AA Sequence: EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM

Expression Region: 123-276aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 44.6 kDa

Alternative Name(s):

Relevance:

Reference: "cDNA cloning and expression of porcine IL-33."Shimazu T., Tohno M., Kawai Y., Saito T., Kitazawa H.Submitted (FEB-2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share