Gene Bio Systems
Recombinant Pig Interleukin-2 receptor subunit alpha(IL2RA)
Recombinant Pig Interleukin-2 receptor subunit alpha(IL2RA)
SKU:CSB-CF011649PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:O02733
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GACVQQPPSLRNATFKILGYKVGTTLNCDCQRGFRRDPSSGPYMICRGNSSHSFWENKCQCMPTSSPRIPVKQVTPRPEEQKERKTTETQGQMQPPNQANLPGHCKEPPPWEHESLKRVYHFMEGQTVRYQCLPGFRDGSAQNNSAQSVCKKQEDQEVMRWTQPKLKCKSEKENGSFPEPQMSTAAPPTTKTSLPTRTKGTTDSQNLTEVPATMQPIIFTTQYQLAVAGCVLLLLSILLLSGLTWQRRR
Protein Names:Recommended name: Interleukin-2 receptor subunit alpha Short name= IL-2 receptor subunit alpha Short name= IL-2-RA Short name= IL-2R subunit alpha Short name= IL2-RA Alternative name(s): CD_antigen= CD25
Gene Names:Name:IL2RA
Expression Region:22-270
Sequence Info:full length protein
