Gene Bio Systems
Recombinant Pig Glycophorin-A(GYPA)
Recombinant Pig Glycophorin-A(GYPA)
SKU:CSB-CF010074PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:P02725
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TETPVTGEQGSATPGNVSNATVTAGKPSATSPGVMTIKNTTAVVQKETGVPESYHQDFSHAEITGIIFAVMAGLLLIIFLIAYLIRRMIKKPLPVPKPQDSPDIGTENTADPSELQDTEDPPLTSVEIETPAS
Protein Names:Recommended name: Glycophorin-A Alternative name(s): CD_antigen= CD235a
Gene Names:Name:GYPA
Expression Region:1-133
Sequence Info:full length protein
