Gene Bio Systems
Recombinant Pig Fetal and adult testis-expressed transcript protein homolog(FATE1)
Recombinant Pig Fetal and adult testis-expressed transcript protein homolog(FATE1)
SKU:CSB-CF856815PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:Q95LB4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGGSTNTKKIEMSLAEELVPKSQEPSREQVLIAEMLEHGIRSLGASQSRQKLDSKISDS AAAWNLAANKSKKTGPQLPPKKASQEPNQEGGFQGMGFLYERNLGADVIAEIGLEELNGL EMEIMRRQLQVITGRLRALEDQGATWRHRETLFFTMLVSVCVANLWLWLRQ
Protein Names:Recommended name: Fetal and adult testis-expressed transcript protein homolog
Gene Names:Name:FATE1 Synonyms:FATE
Expression Region:1-171
Sequence Info:full length protein
