Gene Bio Systems
Recombinant Pig ATP synthase lipid-binding protein, mitochondrial(ATP5G1)
Recombinant Pig ATP synthase lipid-binding protein, mitochondrial(ATP5G1)
SKU:CSB-CF002359PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:A1XQS5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALFEAM GLFCLMVAFLILFAM
Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATP synthase proteolipid P1 ATPase protein 9 ATPase subunit c
Gene Names:Name:ATP5G1
Expression Region:62-136
Sequence Info:Full length protein
