Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:Q30C86
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKYPLVPLVNELTFSFLASWLCLPVGLLLFLLIVWLRFLLSQDSEENDSDLCFDWEPWSK GPAEFCQEETLHSPEEERPCW
Protein Names:Recommended name: Adipogenin Alternative name(s): Small adipocyte factor 1 Short name= SMAF-1
Gene Names:Name:ADIG Synonyms:SMAF1
Expression Region:1-81
Sequence Info:full length protein